PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA210G00005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 444aa    MW: 47704.5 Da    PI: 8.8777
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA210G00005genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.32e-14344392553
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+ +  e+ 
  AA210G00005 344 RRQRRMIKNRESAARSRARKQAYTVELEAEVAKLKEENERLQRKQAEIL 392
                  79*************************************9976544443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.7E-15334403No hitNo description
SMARTSM003381.0E-14340405IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.346342391IPR004827Basic-leucine zipper domain
PfamPF001704.9E-12344394IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.5E-11344393No hitNo description
CDDcd147071.05E-28344398No hitNo description
PROSITE patternPS000360347362IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MGSQLNFKNL GNEPPGDGGG GMNRLSQGNT PLTRQGSIYS LTFDEFQSSL GKDFGSLNMD  60
ELLKNIWSAE ETQAMASTSG IPVSGQDGLQ RQGSLTLPRT LSQKTVDEVW KDLSKEYISG  120
KDRGVGGTNM SQTHTQRQQT LGEVTLEEFL VRAGVVREEN QMASNLKPDK GGFFGNPLPA  180
SASPVRFQQA SGVAASLMTN LGPDAANHMQ GQGSSLPLNV NGVRLIDQQH HCVQQQPIMP  240
KQPGFGYGTK IGLPNGQVTN PGIRSGLMGV GDHSLTNNMG LVQGGLGLTG AVGVGAVSPV  300
TPLSSEGIGK SNGDSSSLSP SPYMFNGGVR GRKSSGVVEK VVERRQRRMI KNRESAARSR  360
ARKQAYTVEL EAEVAKLKEE NERLQRKQAE ILEMQKNQLN NYLIANIFKV MNLVVYATGD  420
GDDESSRRAA EKAEEDAVRS LVNE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010538116.11e-173PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
RefseqXP_010538117.11e-173PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9M7Q41e-167AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLA0A0D3CNT11e-163A0A0D3CNT1_BRAOL; Uncharacterized protein
TrEMBLI6ZMF51e-163I6ZMF5_EUTSA; Abscisic acid responsive elements-binding factor 2
STRINGBra040260.1-P1e-162(Brassica rapa)
STRINGAT1G45249.31e-161(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.11e-122abscisic acid responsive elements-binding factor 2